Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TXN (Human) Recombinant Protein (Q01)

  • Catalog # : H00007295-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TXN partial ORF ( AAH03377, 1 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.29
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007295-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7295
  • Gene Name:
  • TXN
  • Gene Alias:
  • DKFZp686B1993,MGC61975,TRX,TRX1
  • Gene Description:
  • thioredoxin
  • Gene Summary:
  • Thioredoxin is a 12-kD oxidoreductase enzyme containing a dithiol-disulfide active site. It is ubiquitous and found in many organisms from plants and bacteria to mammals. Multiple in vitro substrates for thioredoxin have been identified, including ribonuclease, choriogonadotropins, coagulation factors, glucocorticoid receptor, and insulin. Reduction of insulin is classically used as an activity test.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000021892
  • RSS
  • YouTube
  • Linkedin
  • Facebook