TXN monoclonal antibody (M01), clone 2A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TXN.
Immunogen
TXN (AAH03377, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (89)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TXN monoclonal antibody (M01), clone 2A7 Western Blot analysis of TXN expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TXN expression in transfected 293T cell line by TXN monoclonal antibody (M01), clone 2A7.
Lane 1: TXN transfected lysate(11.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of TXN transfected lysate using anti-TXN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TXN MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TXN is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TXN on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TXN
Entrez GeneID
7295GeneBank Accession#
BC003377Protein Accession#
AAH03377Gene Name
TXN
Gene Alias
DKFZp686B1993, MGC61975, TRX, TRX1
Gene Description
thioredoxin
Omim ID
187700Gene Ontology
HyperlinkGene Summary
Thioredoxin is a 12-kD oxidoreductase enzyme containing a dithiol-disulfide active site. It is ubiquitous and found in many organisms from plants and bacteria to mammals. Multiple in vitro substrates for thioredoxin have been identified, including ribonuclease, choriogonadotropins, coagulation factors, glucocorticoid receptor, and insulin. Reduction of insulin is classically used as an activity test.[supplied by OMIM
Other Designations
OTTHUMP00000021892
-
Interactome
-
Disease
-
Publication Reference
-
Global analysis of erythroid cells redox status reveals the involvement of Prdx1 and Prdx2 in the severity of beta thalassemia.
Romanello KS, Teixeira KKL, Silva JPMO, Nagamatsu ST, Bezerra MAC, Domingos IF, Martins DAP, Araujo AS, Lanaro C, Breyer CA, Ferreira RA, Franco-Penteado C, Costa FF, Malavazi I, Netto LES, de Oliveira MA, Cunha AF.
PLoS One 2018 Dec; 13(12):e0208316.
Application:WB, Human, Erythrocytes of patients with β-thalassemia.
-
Response of esophageal cancer cells to epigenetic inhibitors is mediated via altered thioredoxin activity.
Ahrens TD, Timme S, Ostendorp J, Bogatyreva L, Hoeppner J, Hopt UT, Hauschke D, Werner M, Lassmann S.
Laboratory Investigation 2016 Mar; 96(3):307.
Application:IF, Human, Het-1A, OE21, OE33 cells.
-
Global analysis of erythroid cells redox status reveals the involvement of Prdx1 and Prdx2 in the severity of beta thalassemia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com