Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF4 polyclonal antibody (A01)

  • Catalog # : H00007293-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TNFRSF4.
  • Immunogen:
  • TNFRSF4 (NP_003318, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • CVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007293-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7293
  • Gene Name:
  • TNFRSF4
  • Gene Alias:
  • ACT35,CD134,OX40,TXGP1L
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 4
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation. [provided by RefSeq
  • Other Designations:
  • ATC35 antigen,CD134 antigen,OTTHUMP00000001522,OX40 antigen,OX40 cell surface antigen,OX40 homologue,lymphoid activation antigene ACT35,tax-transcriptionally activated glycoprotein 1 receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook