Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFSF4 (Human) Recombinant Protein (P01)

  • Catalog # : H00007292-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFSF4 full-length ORF ( NP_003317.1, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 47.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007292-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7292
  • Gene Name:
  • TNFSF4
  • Gene Alias:
  • CD134L,CD252,GP34,OX-40L,OX4OL,TXGP1
  • Gene Description:
  • tumor necrosis factor (ligand) superfamily, member 4
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF4/OX4. It is found to be involved in T cell antigen-presenting cell (APC) interactions. In surface Ig- and CD40-stimulated B cells, this cytokine along with CD70 has been shown to provide CD28-independent costimulatory signals to T cells. This protein and its receptor are reported to directly mediate adhesion of activated T cells to vascular endothelial cells. [provided by RefSeq
  • Other Designations:
  • CD134 ligand,OTTHUMP00000032704,OX40 antigen ligand,OX40 ligand,glycoprotein 34 kd,tax-transcriptionally activated glycoprotein 1 (34kD)
  • RSS
  • YouTube
  • Linkedin
  • Facebook