Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFSF4 (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00007292-H01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified TNFSF4 (NP_003317.1, 52 a.a. - 183 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293T cells
  • Sequence:
  • VSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 19.8
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-TNFSF4 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    SDS-PAGE Gel
    QC Testing of H00007292-H01

    Western Blot
    QC Testing of H00007292-H01
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 7292
  • Gene Name:
  • TNFSF4
  • Gene Alias:
  • CD134L,CD252,GP34,OX-40L,OX4OL,TXGP1
  • Gene Description:
  • tumor necrosis factor (ligand) superfamily, member 4
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF4/OX4. It is found to be involved in T cell antigen-presenting cell (APC) interactions. In surface Ig- and CD40-stimulated B cells, this cytokine along with CD70 has been shown to provide CD28-independent costimulatory signals to T cells. This protein and its receptor are reported to directly mediate adhesion of activated T cells to vascular endothelial cells. [provided by RefSeq
  • Other Designations:
  • CD134 ligand,OTTHUMP00000032704,OX40 antigen ligand,OX40 ligand,glycoprotein 34 kd,tax-transcriptionally activated glycoprotein 1 (34kD)
  • RSS
  • YouTube
  • Linkedin
  • Facebook