Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFSF4 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00007292-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TNFSF4 protein.
  • Immunogen:
  • TNFSF4 (NP_003317.1, 1 a.a. ~ 183 a.a) full-length human protein.
  • Sequence:
  • MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TNFSF4 expression in transfected 293T cell line (H00007292-T01) by TNFSF4 MaxPab polyclonal antibody.

    Lane 1: TNFSF4 transfected lysate(20.13 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7292
  • Gene Name:
  • TNFSF4
  • Gene Alias:
  • CD134L,CD252,GP34,OX-40L,OX4OL,TXGP1
  • Gene Description:
  • tumor necrosis factor (ligand) superfamily, member 4
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF4/OX4. It is found to be involved in T cell antigen-presenting cell (APC) interactions. In surface Ig- and CD40-stimulated B cells, this cytokine along with CD70 has been shown to provide CD28-independent costimulatory signals to T cells. This protein and its receptor are reported to directly mediate adhesion of activated T cells to vascular endothelial cells. [provided by RefSeq
  • Other Designations:
  • CD134 ligand,OTTHUMP00000032704,OX40 antigen ligand,OX40 ligand,glycoprotein 34 kd,tax-transcriptionally activated glycoprotein 1 (34kD)
  • RSS
  • YouTube
  • Linkedin
  • Facebook