DNAJC7 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
DNAJC7 MaxPab rabbit polyclonal antibody. Western Blot analysis of DNAJC7 expression in human liver.
Western Blot (Tissue lysate)
DNAJC7 MaxPab rabbit polyclonal antibody. Western Blot analysis of DNAJC7 expression in mouse liver.
Western Blot (Transfected lysate)
Western Blot analysis of DNAJC7 expression in transfected 293T cell line (H00007266-T02) by DNAJC7 MaxPab polyclonal antibody.
Lane 1: DNAJC7 transfected lysate(55.50 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of DNAJC7 transfected lysate using anti-DNAJC7 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with DNAJC7 purified MaxPab mouse polyclonal antibody (B01P) (H00007266-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human DNAJC7 protein.
Immunogen
DNAJC7 (NP_003306.1, 1 a.a. ~ 484 a.a) full-length human protein.
Sequence
MAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DNAJC7 MaxPab rabbit polyclonal antibody. Western Blot analysis of DNAJC7 expression in human liver.Western Blot (Tissue lysate)
DNAJC7 MaxPab rabbit polyclonal antibody. Western Blot analysis of DNAJC7 expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of DNAJC7 expression in transfected 293T cell line (H00007266-T02) by DNAJC7 MaxPab polyclonal antibody.
Lane 1: DNAJC7 transfected lysate(55.50 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of DNAJC7 transfected lysate using anti-DNAJC7 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with DNAJC7 purified MaxPab mouse polyclonal antibody (B01P) (H00007266-B01P). -
Gene Info — DNAJC7
Entrez GeneID
7266GeneBank Accession#
NM_003315Protein Accession#
NP_003306.1Gene Name
DNAJC7
Gene Alias
DANJC7, DJ11, TPR2, TTC2
Gene Description
DnaJ (Hsp40) homolog, subfamily C, member 7
Omim ID
601964Gene Ontology
HyperlinkGene Summary
DNAJC7 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 [PubMed 11147971]).[supplied by OMIM
Other Designations
tetratricopeptide repeat domain 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com