TSTA3 monoclonal antibody (M01), clone 2B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TSTA3.
Immunogen
TSTA3 (NP_003304, 222 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
Host
Mouse
Reactivity
Human
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TSTA3 monoclonal antibody (M01), clone 2B9 Western Blot analysis of TSTA3 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TSTA3 expression in transfected 293T cell line by TSTA3 monoclonal antibody (M01), clone 2B9.
Lane 1: TSTA3 transfected lysate(35.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TSTA3 is 0.3 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TSTA3 over-expressed 293 cell line, cotransfected with TSTA3 Validated Chimera RNAi ( Cat # H00007264-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TSTA3 monoclonal antibody (M01), clone 2B9 (Cat # H00007264-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — TSTA3
Entrez GeneID
7264GeneBank Accession#
NM_003313Protein Accession#
NP_003304Gene Name
TSTA3
Gene Alias
FX, P35B, SDR4E1
Gene Description
tissue specific transplantation antigen P35B
Omim ID
137020Gene Ontology
HyperlinkGene Summary
Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II. [provided by RefSeq
Other Designations
3-5 epimerase/4-reductase|GDP-4-keto-6-deoxy-D-mannose epimerase-reductase|Tissue-specific transplantation antigen-3|short chain dehydrogenase/reductase family 4E, member 1|tissue specific transplantation antigen 3
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com