Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TSTA3 polyclonal antibody (A01)

  • Catalog # : H00007264-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TSTA3.
  • Immunogen:
  • TSTA3 (NP_003304, 222 a.a. ~ 321 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007264-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TSTA3 polyclonal antibody (A01), Lot # 060529JCS1. Western Blot analysis of TSTA3 expression in Raw 264.7.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TSTA3 polyclonal antibody (A01), Lot # 060529JCS1 Western Blot analysis of TSTA3 expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TSTA3 polyclonal antibody (A01), Lot # 060529JCS1. Western Blot analysis of TSTA3 expression in NIH/3T3.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7264
  • Gene Name:
  • TSTA3
  • Gene Alias:
  • FX,P35B,SDR4E1
  • Gene Description:
  • tissue specific transplantation antigen P35B
  • Gene Summary:
  • Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II. [provided by RefSeq
  • Other Designations:
  • 3-5 epimerase/4-reductase,GDP-4-keto-6-deoxy-D-mannose epimerase-reductase,Tissue-specific transplantation antigen-3,short chain dehydrogenase/reductase family 4E, member 1,tissue specific transplantation antigen 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook