Product Browser

Last updated: 2017/1/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PHLDA2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007262-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PHLDA2 partial ORF ( NP_003302, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007262-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7262
  • Gene Name:
  • PHLDA2
  • Gene Alias:
  • BRW1C,BWR1C,HLDA2,IPL,TSSC3
  • Gene Description:
  • pleckstrin homology-like domain, family A, member 2
  • Gene Summary:
  • This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Studies of the mouse gene, however, which is also located in an imprinted gene domain, have shown that the product of this gene regulates placental growth. [provided by RefSeq
  • Other Designations:
  • imprinted in placenta and liver,p17-Beckwith-Wiedemann region 1C,pleckstrin homology-like domain family A member 2,tumor suppressing subchromosomal transferable fragment cDNA 3,tumor suppressing subtransferable candidate 3,tumor-supressing STF cDNA 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook