Product Browser

Last updated: 2016/12/11
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRPC6 polyclonal antibody (A01)

  • Catalog # : H00007225-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TRPC6.
  • Immunogen:
  • TRPC6 (NP_004612, 543 a.a. ~ 592 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007225-A01
    Western Blot detection against Immunogen (31.61 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7225
  • Gene Name:
  • TRPC6
  • Gene Alias:
  • FLJ11098,FLJ14863,FSGS2,TRP6
  • Gene Description:
  • transient receptor potential cation channel, subfamily C, member 6
  • Gene Summary:
  • The protein encoded by this gene forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2). [provided by RefSeq
  • Other Designations:
  • transient receptor potential channel 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook