TRIP6 monoclonal antibody (M04), clone 4B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TRIP6 monoclonal antibody (M04), clone 4B7 Western Blot analysis of TRIP6 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of TRIP6 expression in transfected 293T cell line by TRIP6 monoclonal antibody (M04), clone 4B7.
Lane 1: TRIP6 transfected lysate(50.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRIP6 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to TRIP6 on HeLa cell. [antibody concentration 35 ug/ml]
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRIP6.
Immunogen
TRIP6 (NP_003293, 51 a.a. ~ 148 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASP
Host
Mouse
Reactivity
Human
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TRIP6 monoclonal antibody (M04), clone 4B7 Western Blot analysis of TRIP6 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of TRIP6 expression in transfected 293T cell line by TRIP6 monoclonal antibody (M04), clone 4B7.
Lane 1: TRIP6 transfected lysate(50.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRIP6 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TRIP6 on HeLa cell. [antibody concentration 35 ug/ml] -
Gene Info — TRIP6
Entrez GeneID
7205GeneBank Accession#
NM_003302Protein Accession#
NP_003293Gene Name
TRIP6
Gene Alias
MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP1, ZRP-1
Gene Description
thyroid hormone receptor interactor 6
Omim ID
602933Gene Ontology
HyperlinkGene Summary
This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphatidic acid (LPA)-dependent manner and it regulates LPA-induced cell migration. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
Other Designations
OPA-interacting protein 1|thyroid receptor-interacting protein 6|zyxin related protein 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com