TRIO polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant TRIO.
Immunogen
TRIO (NP_009049, 1961 a.a. ~ 2070 a.a) partial recombinant protein with GST tag.
Sequence
ERKSSSLKRRHYVLQELVETERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEKCLEDPEKLGSLFVKHERRLHMYIAYCQNKPKSEH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TRIO polyclonal antibody (A01), Lot # ABNOVA060705QCS1 Western Blot analysis of TRIO expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — TRIO
-
Interactome
-
Disease
-
Publication Reference
-
Rab6 regulates cell migration and invasion by recruiting Cdc42 and modulating its activity.
Vestre K, Kjos I, Guadagno NA, Borg Distefano M, Kohler F, Fenaroli F, Bakke O, Progida C.
Cellular and Molecular Life Sciences : CMLS 2019 Mar; [Epub].
Application:WB, Human, HeLa, U-2 OS cells.
-
Flow-induced endothelial cell alignment requires the RhoGEF Trio as a scaffold protein to polarize active Rac1 distribution.
Kroon J, Heemskerk N, Kalsbeek MJT, de Waard V, van Rijssel J, van Buul JD.
Molecular Biology of the Cell 2017 May; 28(13):1745.
Application:WB, Human, HUVEC.
-
Upregulated TRIO expression correlates with a malignant phenotype in human hepatocellular carcinoma.
Wang B, Fang J, Qu L, Cao Z, Zhou J, Deng B.
Tumour Biology 2015 Sep; 36(9):6901.
Application:WB-Ce, WB-Tr, Human, HUVECs, LO2, SMMC-7721, sk-Hep1, Huh7, Hep3B, Huh7-siControl, Huh7-siRNA, Huh7-siTRIO, Hep3B-siControl, Hep3B-siRNA, Hep3B-siTRIO cells.
-
The Rho-guanine nucleotide exchange factor Trio controls leukocyte transendothelial migration by promoting docking structure formation.
van Rijssel J, Kroon J, Hoogenboezem M, van Alphen FP, de Jong RJ, Kostadinova E, Geerts D, Hordijk PL, van Buul JD.
Molecular Biology of the Cell 2012 Aug; 23(15):2831.
Application:WB-Ce, Human, HMVECs, HUVECs.
-
Tara up-regulates E-cadherin transcription by binding to the Trio RhoGEF and inhibiting Rac signaling.
Yano T, Yamazaki Y, Adachi M, Okawa K, Fort P, Uji M, Tsukita S, Tsukita S.
J Cell Biol 2011 Apr; 193:319.
Application:IF, WB-Ti, Dog, Mouse, Liver, Bile canaliculi, Junctional fraction, MDCK cells.
-
Rab6 regulates cell migration and invasion by recruiting Cdc42 and modulating its activity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com