TRAF6 monoclonal antibody (M02), clone 1B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRAF6.
Immunogen
TRAF6 (AAH31052, 413 a.a. ~ 522 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TRAF6 expression in transfected 293T cell line by TRAF6 monoclonal antibody (M02), clone 1B2.
Lane 1: TRAF6 transfected lysate(59.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRAF6 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TRAF6 over-expressed 293 cell line, cotransfected with TRAF6 Validated Chimera RNAi ( Cat # H00007189-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TRAF6 monoclonal antibody (M02), clone 1B2 (Cat # H00007189-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TRAF4 and TRAF6. HeLa cells were stained with anti-TRAF4 rabbit purified polyclonal 1:1200 and anti-TRAF6 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — TRAF6
Entrez GeneID
7189GeneBank Accession#
BC031052Protein Accession#
AAH31052Gene Name
TRAF6
Gene Alias
MGC:3310, RNF85
Gene Description
TNF receptor-associated factor 6
Omim ID
602355Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein mediates the signaling not only from the members of the TNF receptor superfamily, but also from the members of the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. This protein also interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein. Two alternatively spliced transcript variants encoding identical proteins have been reported. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com