Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRAF3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007187-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TRAF3 partial ORF ( NP_663777, 298 a.a. - 410 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • FEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.17
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007187-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7187
  • Gene Name:
  • TRAF3
  • Gene Alias:
  • CAP-1,CD40bp,CRAF1,LAP1
  • Gene Description:
  • TNF receptor-associated factor 3
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • CD40 associated protein 1,CD40 binding protein,CD40 receptor associated factor 1,LMP1 associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook