NR2C2 monoclonal antibody (M01), clone 2A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NR2C2.
Immunogen
NR2C2 (NP_003289, 43 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVS
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NR2C2 expression in transfected 293T cell line by NR2C2 monoclonal antibody (M01), clone 2A5.
Lane 1: NR2C2 transfected lysate(65.414 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NR2C2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of NR2C2 over-expressed 293 cell line, cotransfected with NR2C2 Validated Chimera RNAi ( Cat # H00007182-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NR2C2 monoclonal antibody (M01), clone 2A5 (Cat # H00007182-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — NR2C2
Entrez GeneID
7182GeneBank Accession#
NM_003298Protein Accession#
NP_003289Gene Name
NR2C2
Gene Alias
TAK1, TR2R1, TR4, hTAK1
Gene Description
nuclear receptor subfamily 2, group C, member 2
Omim ID
601426Gene Ontology
HyperlinkGene Summary
Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes (Yoshikawa et al., 1996 [PubMed 8661150]).[supplied by OMIM
Other Designations
Nuclear hormone receptor TR4|OTTHUMP00000160276|TR4 nuclear hormone receptor
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com