TPT1 monoclonal antibody (M03), clone 2C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TPT1.
Immunogen
TPT1 (AAH22436, 35 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TPT1 monoclonal antibody (M03), clone 2C4 Western Blot analysis of TPT1 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Cell lysate)
TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TPT1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — TPT1
Entrez GeneID
7178GeneBank Accession#
BC022436Protein Accession#
AAH22436Gene Name
TPT1
Gene Alias
FLJ27337, HRF, TCTP, p02
Gene Description
tumor protein, translationally-controlled 1
Omim ID
600763Gene Ontology
HyperlinkGene Summary
O
Other Designations
OTTHUMP00000018344|fortilin|histamine-releasing factor
-
Interactome
-
Disease
-
Publication Reference
-
Histamine-releasing factor in severe asthma and rhinovirus-associated asthma exacerbation.
Yu Kawakami, Ikuo Takazawa, Merritt L Fajt, Kazumi Kasakura, Joseph Lin, Julienne Ferrer, David B Kantor, Wanda Phipatanakul, Peter W Heymann, Chris A Benedict, Yuko Kawakami, Toshiaki Kawakami.
The Journal of Allergy and Clinical Immunology 2023 Jun; S0091-6749(23):00707-8.
Application:ELISA, Human, Human serum.
-
Histamine-Releasing Factor Is a Novel Alarmin Induced by House Dust Mite Allergen, Cytokines, and Cell Death.
Kazumi Kasakura, Yu Kawakami, Alain Jacquet, Toshiaki Kawakami.
Journal of immunology 2022 Nov; 209(10):1851.
Application:WB-Ce, Human, BEAS-2B cells.
-
Fortilin inhibits p53, halts cardiomyocyte apoptosis, and protects the heart against heart failure.
Preedakorn Chunhacha, Decha Pinkaew, Patuma Sinthujaroen, Dawn E Bowles, Ken Fujise.
Cell Death Discovery 2021 Oct; 7(1):310.
Application:WB-Ti, WB-Tr, Mouse, Mouse heart, Mouse kidney, Mouse liver, Mouse lung, Mouse spleen.
-
Methomyl induced effect on fortilin and S100A1 in serum and cardiac tissue: Potential biomarkers of toxicity.
Nusair SD, Joukhan AN, Rashaid AB, Rababa'h AM.
Human & Experimental Toxicology 2018 Nov; 960327118814153.
Application:Cap Ab, Rat, Rat serum.
-
Elevation of serum fortilin levels is specific for apoptosis and signifies cell death in vivo.
Sinthujaroen P, Wanachottrakul N, Pinkaew D, Petersen JR, Phongdara A, Sheffield-Moore M, Fujise K.
BBA Clinical 2014 Dec; 2:103.
Application:ELISA, Human, Mouse, Serum.
-
Histamine-releasing factor in severe asthma and rhinovirus-associated asthma exacerbation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com