TPSAB1 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TPSAB1 protein.
Immunogen
TPSAB1 (NP_003285, 1 a.a. ~ 275 a.a) full-length human protein.
Sequence
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (76)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TPSAB1 MaxPab polyclonal antibody. Western Blot analysis of TPSAB1 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of TPSAB1 expression in transfected 293T cell line (H00007177-T02) by TPSAB1 MaxPab polyclonal antibody.
Lane 1: TPSAB1 transfected lysate(30.25 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TPSAB1
Entrez GeneID
7177GeneBank Accession#
NM_003294Protein Accession#
NP_003285Gene Name
TPSAB1
Gene Alias
MCP7, TPS1, TPS2, TPSB1
Gene Description
tryptase alpha/beta 1
Omim ID
191080Gene Ontology
HyperlinkGene Summary
Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, alpha and beta 1. Beta tryptases appear to be the main isoenzymes expressed in mast cells; whereas in basophils, alpha tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. [provided by RefSeq
Other Designations
lung tryptase|mast cell protease II|mast cell tryptase|pituitary tryptase|skin tryptase|tryptase 1|tryptase II|tryptase alpha II|tryptase beta 1|tryptase beta I|tryptase, alpha|tryptase-I|tryptase-III
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com