TPR monoclonal antibody (M01), clone 1A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TPR on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TPR is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TPR.
Immunogen
TPR (NP_003283, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKRLSHSQERLVNETRECQSLRLELEKLNNQLKALTEKNKE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TPR on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TPR is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — TPR
Entrez GeneID
7175GeneBank Accession#
NM_003292Protein Accession#
NP_003283Gene Name
TPR
Gene Alias
-
Gene Description
translocated promoter region (to activated MET oncogene)
Omim ID
189940Gene Ontology
HyperlinkGene Summary
This gene encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRNAs and some proteins. Oncogenic fusions of the 5' end of this gene with several different kinase genes occur in some neoplasias. [provided by RefSeq
Other Designations
OTTHUMP00000033584|nuclear pore complex-associated protein TPR|nucleoprotein TPR|tumor potentiating region
-
Interactome
-
Pathway
-
Publication Reference
-
Herpes simplex virus replication: roles of viral proteins and nucleoporins in capsid-nucleus attachment.
Copeland AM, Newcomb WW, Brown JC.
Journal of Virology 2008 Dec; 83(4):1660.
Application：WB-Tr, Monkey, Vero cells.
-
Quantitative Analysis of HIV-1 Infected CD4+ Cell Proteome: Dysregulated Cell Cycle Progression and Nuclear Transport Coincide with Robust Virus Production.
Chan EY, Qian WJ, Diamond DL, Liu T, Gritsenko MA, Monroe ME, Camp DG 2nd, Smith RD, Katze MG.
Journal of Virology 2007 May; 81(14):7571.
Application：WB, Human, Human CEMx174 cells.
-
Herpes simplex virus replication: roles of viral proteins and nucleoporins in capsid-nucleus attachment.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com