Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TPH1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007166-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TPH1 partial ORF ( NP_004170, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MIEDNKENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEFEIFVDCDINREQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.61
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007166-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7166
  • Gene Name:
  • TPH1
  • Gene Alias:
  • MGC119994,TPH,TPRH
  • Gene Description:
  • tryptophan hydroxylase 1
  • Gene Summary:
  • This gene encodes a member of the aromatic amino acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. Mutations in this gene have been associated with an elevated risk for a variety of diseases and disorders, including schizophrenia, somatic anxiety, anger-related traits, bipolar disorder, suicidal behavior, addictions, and others
  • Other Designations:
  • indoleacetic acid-5-hydroxylase,tryptophan 5-hydroxylase,tryptophan 5-monooxygenase,tryptophan hydroxylase (tryptophan 5-monooxygenase)
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook