Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TPH1 polyclonal antibody (A01)

  • Catalog # : H00007166-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TPH1.
  • Immunogen:
  • TPH1 (NP_004170, 1 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MIEDNKENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEFEIFVDCDINREQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7166
  • Gene Name:
  • TPH1
  • Gene Alias:
  • MGC119994,TPH,TPRH
  • Gene Description:
  • tryptophan hydroxylase 1
  • Gene Summary:
  • This gene encodes a member of the aromatic amino acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. Mutations in this gene have been associated with an elevated risk for a variety of diseases and disorders, including schizophrenia, somatic anxiety, anger-related traits, bipolar disorder, suicidal behavior, addictions, and others
  • Other Designations:
  • indoleacetic acid-5-hydroxylase,tryptophan 5-hydroxylase,tryptophan 5-monooxygenase,tryptophan hydroxylase (tryptophan 5-monooxygenase)
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook