TPD52L1 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TPD52L1 expression in transfected 293T cell line (H00007164-T02) by TPD52L1 MaxPab polyclonal antibody.
Lane 1: TPD52L1 transfected lysate(22.44 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TPD52L1 protein.
Immunogen
TPD52L1 (NP_003278.1, 1 a.a. ~ 204 a.a) full-length human protein.
Sequence
MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TPD52L1 expression in transfected 293T cell line (H00007164-T02) by TPD52L1 MaxPab polyclonal antibody.
Lane 1: TPD52L1 transfected lysate(22.44 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TPD52L1
Entrez GeneID
7164GeneBank Accession#
NM_003287.2Protein Accession#
NP_003278.1Gene Name
TPD52L1
Gene Alias
D53, MGC8556, TPD52L2, hD53
Gene Description
tumor protein D52-like 1
Omim ID
604069Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the tumor protein D52 (TPD52) family. The encoded protein contains a coiled-coil domain and may form homo- or hetero-dimer with TPD52 family members. The protein is reported to be involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase kinase kinase 5 (MAP3K5/ASK1) and positively regulates MAP3K5-induced apoptosis. Multiple alternatively spliced transcript variants have been observed, but the full-length nature of some variants has not yet been determined. [provided by RefSeq
Other Designations
OTTHUMP00000017133|OTTHUMP00000017135|OTTHUMP00000017136|tumor protein D52-like 2|tumor protein D53
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com