TP53BP2 monoclonal antibody (M01), clone 3F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TP53BP2 monoclonal antibody (M01), clone 3F8 Western Blot analysis of TP53BP2 expression in HepG2 ( Cat # L019V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TP53BP2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TP53BP2 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TP53BP2.
Immunogen
TP53BP2 (AAH58918, 511 a.a. ~ 610 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (78)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TP53BP2 monoclonal antibody (M01), clone 3F8 Western Blot analysis of TP53BP2 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TP53BP2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TP53BP2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — TP53BP2
Entrez GeneID
7159GeneBank Accession#
BC058918Protein Accession#
AAH58918Gene Name
TP53BP2
Gene Alias
53BP2, ASPP2, BBP, PPP1R13A, p53BP2
Gene Description
tumor protein p53 binding protein, 2
Omim ID
602143Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear region of the cytoplasm, and regulates apoptosis and cell growth through interactions with other regulatory molecules including members of the p53 family. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
BCL2-binding protein|NY-REN-51 antigen|apoptosis-stimulating protein of p53, 2|tumor suppressor p53-binding protein 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com