TOP2B (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TOP2B partial ORF ( NP_001059, 1411 a.a. - 1523 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LDKDEYTFSPGKSKATPEKSLHDKKSQDFGNLFSFPSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVAAKKGKPSSDTVPKPKRAPKQKKVVEAVNSDSDSEF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
38.17
Interspecies Antigen Sequence
Mouse (88); Rat (84)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TOP2B
Entrez GeneID
7155GeneBank Accession#
NM_001068Protein Accession#
NP_001059Gene Name
TOP2B
Gene Alias
TOPIIB, top2beta
Gene Description
topoisomerase (DNA) II beta 180kDa
Omim ID
126431Gene Ontology
HyperlinkGene Summary
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, beta, is localized to chromosome 3 and the alpha form is localized to chromosome 17. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. Alternative splicing of this gene results in two transcript variants; however, the second variant has not yet been fully described. [provided by RefSeq
Other Designations
DNA topoisomerase II beta|DNA topoisomerase II, 180 kD|DNA topoisomerase II, beta isozyme|U937 associated antigen|antigen MLAA-44|topo II beta|topoisomerase (DNA) II beta (180kD)|topoisomerase II beta|topoisomerase IIb
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com