TOP2B polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant TOP2B.
Immunogen
TOP2B (NP_001059, 1411 a.a. ~ 1523 a.a) partial recombinant protein with GST tag.
Sequence
LDKDEYTFSPGKSKATPEKSLHDKKSQDFGNLFSFPSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVAAKKGKPSSDTVPKPKRAPKQKKVVEAVNSDSDSEF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (84)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.54 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — TOP2B
Entrez GeneID
7155GeneBank Accession#
NM_001068Protein Accession#
NP_001059Gene Name
TOP2B
Gene Alias
TOPIIB, top2beta
Gene Description
topoisomerase (DNA) II beta 180kDa
Omim ID
126431Gene Ontology
HyperlinkGene Summary
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, beta, is localized to chromosome 3 and the alpha form is localized to chromosome 17. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. Alternative splicing of this gene results in two transcript variants; however, the second variant has not yet been fully described. [provided by RefSeq
Other Designations
DNA topoisomerase II beta|DNA topoisomerase II, 180 kD|DNA topoisomerase II, beta isozyme|U937 associated antigen|antigen MLAA-44|topo II beta|topoisomerase (DNA) II beta (180kD)|topoisomerase II beta|topoisomerase IIb
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com