Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TOP1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007150-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TOP1 partial ORF ( NP_003277, 692 a.a. - 765 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.88
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007150-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7150
  • Gene Name:
  • TOP1
  • Gene Alias:
  • TOPI
  • Gene Description:
  • topoisomerase (DNA) I
  • Gene Summary:
  • This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22. [provided by RefSeq
  • Other Designations:
  • DNA topoisomerase I,OTTHUMP00000031713,type I DNA topoisomerase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook