TOP1 monoclonal antibody (M01), clone 1A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
TOP1 monoclonal antibody (M01), clone 1A1. Western Blot analysis of TOP1 expression in human ovarian cancer.
Western Blot (Cell lysate)
TOP1 monoclonal antibody (M01), clone 1A1. Western Blot analysis of TOP1 expression in HeLa.
Western Blot (Cell lysate)
TOP1 monoclonal antibody (M01), clone 1A1. Western Blot analysis of TOP1 expression in JAR.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1~10 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TOP1 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.88 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TOP1.
Immunogen
TOP1 (NP_003277, 692 a.a. ~ 765 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.88 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TOP1 monoclonal antibody (M01), clone 1A1. Western Blot analysis of TOP1 expression in human ovarian cancer.Western Blot (Cell lysate)
TOP1 monoclonal antibody (M01), clone 1A1. Western Blot analysis of TOP1 expression in HeLa.Western Blot (Cell lysate)
TOP1 monoclonal antibody (M01), clone 1A1. Western Blot analysis of TOP1 expression in JAR.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1~10 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TOP1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — TOP1
Entrez GeneID
7150GeneBank Accession#
NM_003286Protein Accession#
NP_003277Gene Name
TOP1
Gene Alias
TOPI
Gene Description
topoisomerase (DNA) I
Omim ID
126420Gene Ontology
HyperlinkGene Summary
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22. [provided by RefSeq
Other Designations
DNA topoisomerase I|OTTHUMP00000031713|type I DNA topoisomerase
-
Interactome
-
Disease
-
Publication Reference
-
AID-induced decrease in topoisomerase 1 induces DNA structural alteration and DNA cleavage for class switch recombination.
Kobayashi M, Aida M, Nagaoka H, Begum NA, Kitawaki Y, Nakata M, Stanlie A, Doi T, Kato L, Okazaki IM, Shinkura R, Muramatsu M, Kinoshita K, Honjo T.
PNAS 2009 Dec; 106(52):22375.
Application：WB, Mouse, AER, NIH/3T3 cells.
-
AID-induced decrease in topoisomerase 1 induces DNA structural alteration and DNA cleavage for class switch recombination.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com