Product Browser

Last updated: 2017/6/18
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TOP1 polyclonal antibody (A01)

  • Catalog # : H00007150-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TOP1.
  • Immunogen:
  • TOP1 (NP_003277, 692 a.a. ~ 765 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007150-A01
    Western Blot detection against Immunogen (34.25 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7150
  • Gene Name:
  • TOP1
  • Gene Alias:
  • TOPI
  • Gene Description:
  • topoisomerase (DNA) I
  • Gene Summary:
  • This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22. [provided by RefSeq
  • Other Designations:
  • DNA topoisomerase I,OTTHUMP00000031713,type I DNA topoisomerase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook