TNNI3 monoclonal antibody (M04), clone 1E7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TNNI3.
Immunogen
TNNI3 (NP_000354, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TNNI3 expression in transfected 293T cell line by TNNI3 monoclonal antibody (M04), clone 1E7.
Lane 1: TNNI3 transfected lysate(24 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TNNI3 on formalin-fixed paraffin-embedded human heart. [antibody concentration 0.7 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TNNI3 is 1 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TNNI3 over-expressed 293 cell line, cotransfected with TNNI3 Validated Chimera RNAi ( Cat # H00007137-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TNNI3 monoclonal antibody (M04), clone 1E7 (Cat # H00007137-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to TNNI3 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — TNNI3
Entrez GeneID
7137GeneBank Accession#
NM_000363Protein Accession#
NP_000354Gene Name
TNNI3
Gene Alias
CMD2A, CMH7, MGC116817, RCM1, TNNC1, cTnI
Gene Description
troponin I type 3 (cardiac)
Gene Ontology
HyperlinkGene Summary
Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. This gene encodes the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues. Mutations in this gene cause familial hypertrophic cardiomyopathy type 7 (CMH7) and familial restrictive cardiomyopathy (RCM). [provided by RefSeq
Other Designations
familial hypertrophic cardiomyopathy 7|troponin I, cardiac
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C.
Uys GM, Ramburan A, Loos B, Kinnear CJ, Korkie LJ, Mouton J, Riedemann J, Moolman-Smook JC.
BMC Cell Biology 2011 May; 12:18.
Application:IF, IP, IP-WB, WB-Tr, Rat, H9C2 cardiomyocytes.
-
Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com