Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF1B (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00007133-H01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified TNFRSF1B (AAH52977.1 23 a.a. - 257 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293T cells
  • Sequence:
  • LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 31.13
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-TNFRSF1B plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    Western Blot
    QC Testing of H00007133-H01

    SDS-PAGE Gel
    QC Testing of H00007133-H01
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 7133
  • Gene Name:
  • TNFRSF1B
  • Gene Alias:
  • CD120b,TBPII,TNF-R-II,TNF-R75,TNFBR,TNFR1B,TNFR2,TNFR80,p75,p75TNFR
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 1B
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000001784,p75 TNF receptor,soluble TNFR1B variant 1,tumor necrosis factor beta receptor,tumor necrosis factor binding protein 2,tumor necrosis factor receptor 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook