Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF1A (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00007132-H02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified TNFRSF1A (AAH10140.1 22 a.a. - 211 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293H cells
  • Sequence:
  • IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 26.18
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-TNFRSF1A plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    SDS-PAGE Gel
    QC Testing of H00007132-H02

    Western Blot
    QC Testing of H00007132-H02
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 7132
  • Gene Name:
  • TNFRSF1A
  • Gene Alias:
  • CD120a,FPF,MGC19588,TBP1,TNF-R,TNF-R-I,TNF-R55,TNFAR,TNFR1,TNFR55,TNFR60,p55,p55-R,p60
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 1A
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. [provided by RefSeq
  • Other Designations:
  • tumor necrosis factor binding protein 1,tumor necrosis factor receptor 1,tumor necrosis factor receptor type 1,tumor necrosis factor-alpha receptor
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook