TNF (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TNF full-length ORF ( AAH28148, 1 a.a. - 233 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
51.37
Interspecies Antigen Sequence
Mouse (79); Rat (78)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TNF
Entrez GeneID
7124GeneBank Accession#
BC028148Protein Accession#
AAH28148Gene Name
TNF
Gene Alias
DIF, TNF-alpha, TNFA, TNFSF2
Gene Description
tumor necrosis factor (TNF superfamily, member 2)
Gene Ontology
HyperlinkGene Summary
This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine. [provided by RefSeq
Other Designations
APC1 protein|OTTHUMP00000029281|OTTHUMP00000037669|TNF superfamily, member 2|TNF, macrophage-derived|TNF, monocyte-derived|cachectin|tumor necrosis factor alpha
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Evaluation of novel factor Xa inhibitors from Oxya chinensis sinuosa with anti-platelet aggregation activity.
Lee W, Lee H, Kim MA, Choi J, Kim KM, Hwang JS, Na M, Bae JS.
Scientific Reports 2017 Aug; 7(1):7934.
Application:Func, Human, HUVEC.
-
Aspalathin and nothofagin from rooibos (Aspalathus linearis) inhibit endothelial protein C receptor shedding in vitro and in vivo.
Kwak S, Han MS, Bae JS.
Fitoterapia 2015 Jan; 100:179.
Application:ELISA, Human, Mouse, Primary human umbilical vein endothelial cells (HUVECs), mouse plasma.
-
Antithrombotic Activities of Epi-Sesamin in vitro and in vivo.
Ku SK, Kim JA, Han CK, Bae JS.
The American Journal of Chinese Medicine 2013 Dec; 41(6):1313.
Application:Stimulated, Recombinant protein.
-
Piperlonguminine Downregulates Endothelial Protein C Receptor Shedding In Vitro and In Vivo.
Ku SK, Kim JA, Bae JS.
Inflammation 2014 Apr; 37(2):435.
Application:Incubated, Recombinant protein.
-
Evaluation of novel factor Xa inhibitors from Oxya chinensis sinuosa with anti-platelet aggregation activity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com