Product Browser

Last updated: 2017/1/22
  • Related Product Showcase
  • By Research Area

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLEC3B polyclonal antibody (A01)

  • Catalog # : H00007123-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant CLEC3B.
  • Immunogen:
  • CLEC3B (AAH11024, 1 a.a. ~ 202 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MEVWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNGMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007123-A01
    Western Blot detection against Immunogen (48.33 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7123
  • Gene Name:
  • CLEC3B
  • Gene Alias:
  • DKFZp686H17246,TN,TNA
  • Gene Description:
  • C-type lectin domain family 3, member B
  • Other Designations:
  • tetranectin (plasminogen binding protein),tetranectin (plasminogen-binding protein)
  • RSS
  • YouTube
  • Linkedin
  • Facebook