TMPRSS2 monoclonal antibody (M05), clone 2F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TMPRSS2 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TMPRSS2.
Immunogen
TMPRSS2 (NP_005647, 383 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (85)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TMPRSS2 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — TMPRSS2
Entrez GeneID
7113GeneBank Accession#
NM_005656Protein Accession#
NP_005647Gene Name
TMPRSS2
Gene Alias
FLJ41954, PP9284, PRSS10
Gene Description
transmembrane protease, serine 2
Omim ID
602060Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
epitheliasin
-
Interactome
-
Disease
-
Publication Reference
-
SARS-CoV-2 variants show resistance to neutralization by many monoclonal and serum-derived polyclonal antibodies.
Michael Diamond, Rita Chen, Xuping Xie, James Case, Xianwen Zhang, Laura VanBlargan, Yang Liu, Jianying Liu, John Errico, Emma Winkler, Naveenchandra Suryadevara, Stephen Tahan, Jackson Turner, Wooseob Kim, Aaron Schmitz, Mahima Thapa, David Wang, Andrianus Boon, Dora Pinto, Rachel Presti, Jane Oâ Halloran, Alfred Kim, Parakkal Deepak, Daved Fremont, Davide Corti, Herbert Virgin, James Crowe, Lindsay Droit, Ali Ellebedy, Pei-Yong Shi, Pavlo Gilchuk.
Research Square 2021 Feb; [Epub].
Application：Flow Cyt, Monkey, Vero cells.
-
SARS-CoV-2 variants show resistance to neutralization by many monoclonal and serum-derived polyclonal antibodies.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com