Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TMEM1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007109-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TMEM1 partial ORF ( NP_003265, 1162 a.a. - 1257 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.3
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007109-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7109
  • Gene Name:
  • TRAPPC10
  • Gene Alias:
  • EHOC-1,EHOC1,FLJ54223,FLJ54817,FLJ55683,GT334,MGC126777,TMEM1,TRS130,TRS30
  • Gene Description:
  • trafficking protein particle complex 10
  • Gene Summary:
  • The protein encoded by this gene is a transmembrane protein found in the cis-Golgi complex. The encoded protein is part of the multisubunit transport protein particle (TRAPP) complex and may be involved in vesicular transport from the endoplasmic reticulum to the Golgi. Mutations in this gene could be responsible for the Unverricht-Lundborg type of progressive myoclonus epilepsy, or for autoimmune polyglandular disease type 1. [provided by RefSeq
  • Other Designations:
  • TRAPP 130 kDa subunit,epilepsy holoprosencephaly candidate-1 protein,trafficking protein particle complex subunit 130,transmembrane protein 1,transport protein particle subunit TMEM1
  • RSS
  • YouTube
  • Linkedin
  • Facebook