Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TMEM1 monoclonal antibody (M02), clone 5D5

  • Catalog # : H00007109-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TMEM1.
  • Immunogen:
  • TMEM1 (NP_003265, 1162 a.a. ~ 1257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007109-M02
    Western Blot detection against Immunogen (36.3 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TMEM1 monoclonal antibody (M02), clone 5D5. Western Blot analysis of TMEM1 expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7109
  • Gene Name:
  • TRAPPC10
  • Gene Alias:
  • EHOC-1,EHOC1,FLJ54223,FLJ54817,FLJ55683,GT334,MGC126777,TMEM1,TRS130,TRS30
  • Gene Description:
  • trafficking protein particle complex 10
  • Gene Summary:
  • The protein encoded by this gene is a transmembrane protein found in the cis-Golgi complex. The encoded protein is part of the multisubunit transport protein particle (TRAPP) complex and may be involved in vesicular transport from the endoplasmic reticulum to the Golgi. Mutations in this gene could be responsible for the Unverricht-Lundborg type of progressive myoclonus epilepsy, or for autoimmune polyglandular disease type 1. [provided by RefSeq
  • Other Designations:
  • TRAPP 130 kDa subunit,epilepsy holoprosencephaly candidate-1 protein,trafficking protein particle complex subunit 130,transmembrane protein 1,transport protein particle subunit TMEM1
  • RSS
  • YouTube
  • Linkedin
  • Facebook