TSPAN8 monoclonal antibody (M02), clone 1E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TSPAN8.
Immunogen
TSPAN8 (NP_004607, 110 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN
Host
Mouse
Reactivity
Human
Isotype
IgG3 Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.3 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TSPAN8 expression in transfected 293T cell line by TSPAN8 monoclonal antibody (M02), clone 1E5.
Lane 1: TSPAN8 transfected lysate (Predicted MW: 26.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TSPAN8 is approximately 10ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TSPAN8 on 293T cell . [antibody concentration 10 ug/ml] -
Gene Info — TSPAN8
Entrez GeneID
7103GeneBank Accession#
NM_004616Protein Accession#
NP_004607Gene Name
TSPAN8
Gene Alias
CO-029, TM4SF3
Gene Description
tetraspanin 8
Omim ID
600769Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This gene is expressed in different carcinomas. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq
Other Designations
transmembrane 4 superfamily member 3|tumor-associated antigen CO-029
-
Interactome
-
Disease
-
Publication Reference
-
TM4SF3 promotes esophageal carcinoma metastasis via upregulating ADAM12m expression.
Zhou Z, Ran YL, Hu H, Pan J, Li ZF, Chen LZ, Sun LC, Peng L, Zhao XL, Yu L, Sun LX, Yang ZH.
Clinical & Experimental Metastasis 2008 Mar; 25(5):537.
Application:WB, Human, Human esophageal carcinoma, esophageal carcinoma cell line EC9706 cells.
-
TM4SF3 promotes esophageal carcinoma metastasis via upregulating ADAM12m expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com