Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Disease

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TSPAN8 monoclonal antibody (M02), clone 1E5

  • Catalog # : H00007103-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TSPAN8.
  • Immunogen:
  • TSPAN8 (NP_004607, 110 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG3 Lambda
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007103-M02
    Western Blot detection against Immunogen (36.3 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TSPAN8 expression in transfected 293T cell line by TSPAN8 monoclonal antibody (M02), clone 1E5.

    Lane 1: TSPAN8 transfected lysate (Predicted MW: 26.1 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged TSPAN8 is approximately 10ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7103
  • Gene Name:
  • TSPAN8
  • Gene Alias:
  • CO-029,TM4SF3
  • Gene Description:
  • tetraspanin 8
  • Gene Summary:
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This gene is expressed in different carcinomas. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq
  • Other Designations:
  • transmembrane 4 superfamily member 3,tumor-associated antigen CO-029
  • RSS
  • YouTube
  • Linkedin
  • Facebook