Product Browser

Last updated: 2017/8/20
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TSPAN7 polyclonal antibody (A01)

  • Catalog # : H00007102-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TSPAN7.
  • Immunogen:
  • TSPAN7 (NP_004606, 113 a.a. ~ 212 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007102-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7102
  • Gene Name:
  • TSPAN7
  • Gene Alias:
  • A15,CCG-B7,CD231,DXS1692E,MRX58,MXS1,TALLA-1,TM4SF2,TM4SF2b
  • Gene Description:
  • tetraspanin 7
  • Gene Summary:
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked mental retardation and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy. [provided by RefSeq
  • Other Designations:
  • CD231 antigen,T-cell acute lymphoblastic leukemia associated antigen 1,cell surface glycoprotein A15,membrane component, X chromosome, surface marker 1,tetraspanin protein,transmembrane 4 superfamily 2b,transmembrane 4 superfamily member 2,transmembrane p
  • RSS
  • YouTube
  • Linkedin
  • Facebook