Product Browser

Last updated: 2017/8/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NKX2-1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00007080-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human NKX2-1 protein.
  • Immunogen:
  • NKX2-1 (NP_003308.1, 1 a.a. ~ 371 a.a) full-length human protein.
  • Sequence:
  • MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NKX2-1 expression in transfected 293T cell line (H00007080-T01) by NKX2-1 MaxPab polyclonal antibody.

    Lane1:TITF1 transfected lysate(40.81 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7080
  • Gene Name:
  • NKX2-1
  • Gene Alias:
  • BCH,BHC,NK-2,NKX2.1,NKX2A,TEBP,TITF1,TTF-1,TTF1
  • Gene Description:
  • NK2 homeobox 1
  • Other Designations:
  • NK-2 homolog A,benign chorea,thyroid nuclear factor,thyroid transcription factor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook