TIMP2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TIMP2 protein.
Immunogen
TIMP2 (NP_003246.1, 1 a.a. ~ 220 a.a) full-length human protein.
Sequence
MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TIMP2 MaxPab rabbit polyclonal antibody. Western Blot analysis of TIMP2 expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of TIMP2 expression in transfected 293T cell line (H00007077-T01) by TIMP2 MaxPab polyclonal antibody.
Lane 1: TIMP2 transfected lysate(24.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TIMP2
Entrez GeneID
7077GeneBank Accession#
NM_003255Protein Accession#
NP_003246.1Gene Name
TIMP2
Gene Alias
CSC-21K
Gene Description
TIMP metallopeptidase inhibitor 2
Omim ID
188825Gene Ontology
HyperlinkGene Summary
This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. [provided by RefSeq
Other Designations
tissue inhibitor of metalloproteinase 2|tissue inhibitor of metalloproteinases 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com