Product Browser

Last updated: 2017/10/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TIE1 monoclonal antibody (M18), clone 3E9

  • Catalog # : H00007075-M18
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant TIE1.
  • Immunogen:
  • TIE1 (NP_005415, 536 a.a. ~ 643 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • TLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSG*
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007075-M18
    Western Blot detection against Immunogen (37.99 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TIE1 monoclonal antibody (M18), clone 3E9. Western Blot analysis of TIE1 expression in Hela S3 NE.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7075
  • Gene Name:
  • TIE1
  • Gene Alias:
  • JTK14,TIE
  • Gene Description:
  • tyrosine kinase with immunoglobulin-like and EGF-like domains 1
  • Other Designations:
  • OTTHUMP00000008352,receptor tyrosine kinase,soluble TIE1 variant 1,soluble TIE1 variant 2,soluble TIE1 variant 3,soluble TIE1 variant 4,soluble TIE1 variant 5,tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook