Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TIAL1 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00007073-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TIAL1 protein.
  • Immunogen:
  • TIAL1 (AAH30025.1, 1 a.a. ~ 252 a.a) full-length human protein.
  • Sequence:
  • MDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TIAL1 expression in transfected 293T cell line (H00007073-T01) by TIAL1 MaxPab polyclonal antibody.

    Lane 1: TIAL1 transfected lysate(27.72 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7073
  • Gene Name:
  • TIAL1
  • Gene Alias:
  • MGC33401,TCBP,TIAR
  • Gene Description:
  • TIA1 cytotoxic granule-associated RNA binding protein-like 1
  • Gene Summary:
  • The protein encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020602,OTTHUMP00000020605,T-cluster binding protein,TIA-1 related protein,TIA-1-related nucleolysin,TIA1 cytotoxic granule-associated RNA-binding protein-like 1,aging-associated gene 7 protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook