Product Browser

Last updated: 2017/3/26
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TIAL1 polyclonal antibody (A01)

  • Catalog # : H00007073-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TIAL1.
  • Immunogen:
  • TIAL1 (NP_003243, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007073-A01
    Western Blot detection against Immunogen (36.01 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TIAL1 polyclonal antibody (A01), Lot # 051130JC01 Western Blot analysis of TIAL1 expression in MCF-7 ( Cat # L046V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7073
  • Gene Name:
  • TIAL1
  • Gene Alias:
  • MGC33401,TCBP,TIAR
  • Gene Description:
  • TIA1 cytotoxic granule-associated RNA binding protein-like 1
  • Gene Summary:
  • The protein encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020602,OTTHUMP00000020605,T-cluster binding protein,TIA-1 related protein,TIA-1-related nucleolysin,TIA1 cytotoxic granule-associated RNA-binding protein-like 1,aging-associated gene 7 protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook