THY1 monoclonal antibody (M01), clone 3F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant THY1.
Immunogen
THY1 (AAH05175, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (70); Rat (71)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.34 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
THY1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of THY1 expression in IMR-32.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged THY1 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — THY1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
CD90 is identified as a marker for cancer stem cells in primary high-grade gliomas using tissue microarrays.
He J, Liu Y, Zhu T, Zhu J, Dimeco F, Vescovi AL, Heth JA, Muraszko KM, Fan X, Lubman DM.
Molecular & Cellular Proteomics 2011 Dec; 11(6):M111.
Application:WB, Human, HSR-GBM1 cells.
-
Protein profiling of microdomains purified from renal cell carcinoma and normal kidney tissue samples.
Raimondo F, Morosi L, Chinello C, Perego R, Bianchi C, Albo G, Ferrero S, Rocco F, Magni F, Pitto M.
Molecular BioSystems 2011 Dec; 8(4):1007.
Application:WB, Human, Tissues includes Renal cell carcinoma (RCC) and Adjacent normal kidney (ANK).
-
Differential Profiling Studies of N-linked Glycoproteins in Glioblastoma Cancer Stem Cells upon Treatment with Gamma-Secretase Inhibitor.
Dai L, Liu Y, He J, Flack CG, Talsma CE, Crowley JG, Muraszko KM, Fan X, Lubman DM.
Proteomics 2011 Oct; 11(20):4021.
Application:WB-Ce, Human, Human cancer stem cells.
-
CD90 is identified as a marker for cancer stem cells in primary high-grade gliomas using tissue microarrays.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com