Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

THRSP (Human) Recombinant Protein (P01)

  • Catalog # : H00007069-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human THRSP full-length ORF ( NP_003242.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 43
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007069-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7069
  • Gene Name:
  • THRSP
  • Gene Alias:
  • MGC21659,S14,SPOT14
  • Gene Description:
  • thyroid hormone responsive (SPOT14 homolog, rat)
  • Gene Summary:
  • The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism. [provided by RefSeq
  • Other Designations:
  • spot 14 protein,thyroid hormone responsive SPOT14,thyroid hormone-inducible hepatic protein,thyroid hormone-responsive protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook