THRA (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human THRA partial ORF ( AAH02728, 87 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
PTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRST
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.86
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — THRA
Entrez GeneID
7067GeneBank Accession#
BC002728Protein Accession#
AAH02728Gene Name
THRA
Gene Alias
AR7, EAR7, ERB-T-1, ERBA, ERBA1, MGC000261, MGC43240, NR1A1, THRA1, THRA2, c-ERBA-1
Gene Description
thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian)
Omim ID
190120Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
ERBA-related 7|OTTHUMP00000164470|avian erythroblastic leukemia viral (v-erb-a) oncogene homolog|thyroid hormone receptor alpha|thyroid hormone receptor, alpha|triiodothyronine receptor
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
MuRF1 mono-ubiquitinates TRα to inhibit T3-induced cardiac hypertrophy in vivo.
Wadosky KM, Berthiaume JM, Tang W, Zungu M, Portman MA, Gerdes AM, Willis MS.
Journal of Molecular Endocrinology 2016 Apr; 53(3):273.
Application：Added, Recombinant protein.
-
MuRF1 mono-ubiquitinates TRα to inhibit T3-induced cardiac hypertrophy in vivo.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com