Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

THPO (Human) Recombinant Protein (P01)

  • Catalog # : H00007066-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human THPO full-length ORF ( AAI30323.1, 1 a.a. - 349 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 63.8
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007066-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7066
  • Gene Name:
  • THPO
  • Gene Alias:
  • MGC163194,MGDF,MKCSF,ML,MPLLG,TPO
  • Gene Description:
  • thrombopoietin
  • Gene Summary:
  • Megakaryocytopoiesis is the cellular development process that leads to platelet production. The protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. [provided by RefSeq
  • Other Designations:
  • MPL ligand,c-mpl ligand,megakaryocyte colony-stimulating factor,megakaryocyte growth and development factor,megakaryocyte stimulating factor,myeloproliferative leukemia virus oncogene ligand,thrombopoietin nirs variant 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook