Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TGM2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007052-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TGM2 partial ORF ( AAH03551, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.83
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007052-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7052
  • Gene Name:
  • TGM2
  • Gene Alias:
  • G-ALPHA-h,GNAH,TG2,TGC
  • Gene Description:
  • transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase)
  • Gene Summary:
  • Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. The protein encoded by this gene acts as a monomer, is induced by retinoic acid, and appears to be involved in apoptosis. Finally, the encoded protein is the autoantigen implicated in celiac disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • C polypeptide,OTTHUMP00000030960,TGase C,TGase-H,protein-glutamine-gamma-glutamyltransferase,tissue transglutaminase,transglutaminase 2,transglutaminase C
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook