Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TGFBR1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007046-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TGFBR1 partial ORF ( NP_004603, 30 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.3
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007046-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7046
  • Gene Name:
  • TGFBR1
  • Gene Alias:
  • AAT5,ACVRLK4,ALK-5,ALK5,LDS1A,LDS2A,SKR4,TGFR-1
  • Gene Description:
  • transforming growth factor, beta receptor 1
  • Gene Summary:
  • The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000021783,activin A receptor type II-like kinase, 53kD,activin A receptor type II-like kinase, 53kDa,activin receptor-like kinase 5,serine/threonine-protein kinase receptor R4,transforming growth factor beta receptor I,transforming growth factor,
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook