TGFBR1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
TGFBR1 polyclonal antibody (A01), Lot # ABNOVA060606QCS1. Western Blot analysis of TGFBR1 expression in human spleen.
Western Blot (Cell lysate)
TGFBR1 polyclonal antibody (A01), Lot # ABNOVA060606QCS1. Western Blot analysis of TGFBR1 expression in RIN-m5F.
Western Blot (Cell lysate)
TGFBR1 polyclonal antibody (A01), Lot # ABNOVA060606QCS1 Western Blot analysis of TGFBR1 expression in HepG2 ( Cat # L019V1 ).
Western Blot (Cell lysate)
TGFBR1 polyclonal antibody (A01), Lot # ABNOVA060606QCS1. Western Blot analysis of TGFBR1 expression in Hs 181.Tes.
Western Blot detection against Immunogen (36.67 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant TGFBR1.
Immunogen
TGFBR1 (NP_004603, 30 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
Sequence
GATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (90)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.67 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TGFBR1 polyclonal antibody (A01), Lot # ABNOVA060606QCS1. Western Blot analysis of TGFBR1 expression in human spleen.Western Blot (Cell lysate)
TGFBR1 polyclonal antibody (A01), Lot # ABNOVA060606QCS1. Western Blot analysis of TGFBR1 expression in RIN-m5F.Western Blot (Cell lysate)
TGFBR1 polyclonal antibody (A01), Lot # ABNOVA060606QCS1 Western Blot analysis of TGFBR1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
TGFBR1 polyclonal antibody (A01), Lot # ABNOVA060606QCS1. Western Blot analysis of TGFBR1 expression in Hs 181.Tes.Western Blot (Recombinant protein)
ELISA
-
Gene Info — TGFBR1
Entrez GeneID
7046GeneBank Accession#
NM_004612Protein Accession#
NP_004603Gene Name
TGFBR1
Gene Alias
AAT5, ACVRLK4, ALK-5, ALK5, LDS1A, LDS2A, SKR4, TGFR-1
Gene Description
transforming growth factor, beta receptor 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000021783|activin A receptor type II-like kinase, 53kD|activin A receptor type II-like kinase, 53kDa|activin receptor-like kinase 5|serine/threonine-protein kinase receptor R4|transforming growth factor beta receptor I|transforming growth factor,
-
Interactome
-
Pathway
-
Disease
- Abnormalities
- Adenocarcinoma
- Adenoma
- Aneurysm
- Aortic Aneurysm
- Aortic Rupture
- Asthma
- Atherosclerosis
- Behcet Syndrome
+ View More Disease
-
Publication Reference
-
Fibroblast-enriched endoplasmic reticulum protein TXNDC5 promotes pulmonary fibrosis by augmenting TGFβ signaling through TGFBR1 stabilization.
Tzu-Han Lee, Chih-Fan Yeh, Ying-Tung Lee, Ying-Chun Shih, Yen-Ting Chen, Chen-Ting Hung, Ming-Yi You, Pei-Chen Wu, Tzu-Pin Shentu, Ru-Ting Huang, Yu-Shan Lin, Yueh-Feng Wu, Sung-Jan Lin, Frank-Leigh Lu, Po-Nien Tsao, Tzu-Hung Lin, Shen-Chuan Lo, Yi-Shuan Tseng, Wan-Lin Wu, Chiung-Nien Chen, Chau-Chung Wu, Shuei-Liong Lin, Anne I Sperling, Robert D Guzy, Yun Fang, Kai-Chien Yang.
Nature Communications 2020 Aug; 11(1):4254.
Application：PLA-Ce, Mouse, NIH/3T3 cells.
-
Critical roles of the TGF-beta type I receptor ALK5 in perichondrial formation and function, cartilage integrity, and osteoblast differentiation during growth plate development.
Matsunobu T, Torigoe K, Ishikawa M, de Vega S, Kulkarni AB, Iwamoto Y, Yamada Y.
Developmental Biology 2009 Aug; 332(2):325.
Application：WB, Mouse, Calvarial cells.
-
Fibroblast-enriched endoplasmic reticulum protein TXNDC5 promotes pulmonary fibrosis by augmenting TGFβ signaling through TGFBR1 stabilization.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com