Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TGFBR1 polyclonal antibody (A01)

  • Catalog # : H00007046-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TGFBR1.
  • Immunogen:
  • TGFBR1 (NP_004603, 30 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVE
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007046-A01
    Western Blot detection against Immunogen (36.67 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • TGFBR1 polyclonal antibody (A01), Lot # ABNOVA060606QCS1. Western Blot analysis of TGFBR1 expression in human spleen.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TGFBR1 polyclonal antibody (A01), Lot # ABNOVA060606QCS1 Western Blot analysis of TGFBR1 expression in HepG2 ( Cat # L019V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TGFBR1 polyclonal antibody (A01), Lot # ABNOVA060606QCS1. Western Blot analysis of TGFBR1 expression in Hs 181.Tes.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TGFBR1 polyclonal antibody (A01), Lot # ABNOVA060606QCS1. Western Blot analysis of TGFBR1 expression in RIN-m5F.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7046
  • Gene Name:
  • TGFBR1
  • Gene Alias:
  • AAT5,ACVRLK4,ALK-5,ALK5,LDS1A,LDS2A,SKR4,TGFR-1
  • Gene Description:
  • transforming growth factor, beta receptor 1
  • Gene Summary:
  • The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000021783,activin A receptor type II-like kinase, 53kD,activin A receptor type II-like kinase, 53kDa,activin receptor-like kinase 5,serine/threonine-protein kinase receptor R4,transforming growth factor beta receptor I,transforming growth factor,
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook